PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK18794.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 118aa    MW: 13932.6 Da    PI: 10.401
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK18794.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.62.5e-123679447
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     W ++E+ +++++ ++ G g+Wk+I++   k+Rt+ q+ s+ qk+
        PK18794.1 36 WKKDEHIRFLRGLQEVGRGRWKLISESYVKTRTPSQVASHAQKF 79
                     ******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3522984IPR017930Myb domain
SMARTSM007176.7E-73282IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.3E-123682IPR006447Myb domain, plants
SuperFamilySSF466897.57E-113681IPR009057Homeodomain-like
CDDcd001671.75E-63680No hitNo description
PfamPF002493.3E-93678IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-83681IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
XYRMDRTQRD RDGGTKLFGV DIWKEEEHKP FNVKGWKKDE HIRFLRGLQE VGRGRWKLIS  60
ESYVKTRTPS QVASHAQKFI NKHYIKHGYF SLHESSVDSG GMKILTNVDK EPKKLLQE
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1691138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.26e-16MYB_related family protein